DPCstruct | MC18634
Metacluster Properties and Pfam Annotations
| Number of structural domains | 59 |
|---|---|
| Mean domain length (aa) | 193 ± 31 aa |
| Standard deviation of domain lengths | 31.43 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.25 |
| Pfam Score | 77.50 |
| Assigned Pfam label(s) | PF00591- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V0J6S0 | 29-222 | ASHDTEVVAFLTNMDQPLGNEIGNASEIRESIDVLQGGGPPDLVEITYLLGREMLVLGGVAKTHEAAQDMLSDAVESGRAFEMFRRI… |
| A0A2E6SGA6 | 214-433 | ALELGKNIIHVGKEFGMKTTALITDMNQPLGTNVGNSLEVQEVIDYLTGSERDKRLHEVVLSLSAEMVIIAGLSGSKKEAINEITRV… |
| A0A6G3VMU0 | 2-137 | None |
| A0A2G8L502 | 96-302 | None |
| A0A0V0QF37 | 224-489 | None |
| A0A2P8ZLA9 | 1-155 | None |
| A0A2H5ZND1 | 6-151 | None |
| A0A0K2QZB8 | 12-156 | None |
| A0A645HYP4 | 5-180 | None |
| A0A7X6ZU83 | 24-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.