DPCstruct | MC18629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S5DMW5 | 12-122 | MAKSVEDTLFFRQNMGLALNEVGAEPVTHHFSIERFHHEMKTRQARQPDALSGTSTHDTKRGEDARARLYTLTEAPEQWSECLARWR… |
| A0A535NEW3 | 195-289 | AVMAKGVEDTAFYRYNRLVSLNEVGGDPGSFGRSVEAFHAHCLKTSEKWPATMLTLSTHDTKRSGDVRARTNLLSEIPAEWESAVRR… |
| A0A017HLI0 | 120-206 | None |
| A0A532E898 | 459-586 | None |
| A0A0K2RQK0 | 70-164 | None |
| A0A379AHG0 | 1-111 | None |
| A0A6N9YFC3 | 80-169 | None |
| A0A6I1IRG6 | 86-194 | None |
| A0A257NYG6 | 1-111 | None |
| A0A538DLK1 | 117-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.