DPCstruct | MC18627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 82 ± 4 aa |
| Standard deviation of domain lengths | 3.59 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 90.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 82.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827B393 | 41-122 | ADDGSERLVSTARTTETTYRFTQLALGNYRLTVRAVNAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPT |
| A0A3S4LZJ8 | 1-87 | MAAEDGSDRLVSSAGTPDTQYRFRGLMPGRYTLSVRAVNSQGQQGDPASTQFSISAPAAPSFIELTPGYFQITATPRQAVYDPTVAV |
| A0A6D0VX46 | 373-456 | None |
| A0A6N8MU78 | 167-248 | None |
| A0A828TVN0 | 244-325 | None |
| A0A828B4V2 | 7-89 | None |
| A0A8B2SLR6 | 228-309 | None |
| A0A823AQW0 | 2-70 | None |
| A0A8B2RRM2 | 278-360 | None |
| A0A6D0F188 | 337-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.