DPCstruct | MC18623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 229 ± 32 aa |
| Standard deviation of domain lengths | 32.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 13.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0UR75 | 72-302 | TIKTRKEALRILIEGTMKVEKKTLSDIQISLITALGMEKRGRDFQKLIDKIWFSLPINGVRIYHVGDELYYEIEMEGESIKIRDVEI… |
| B7A953 | 12-215 | EEALSRVQEWIPGVERVLCIQSTPRQYVLVLEGGQKVDIGSVESLASQRKVRVRVAEVLKVLPRWLDQRYWDDMAQAIMDASEDVEA… |
| A0A6I3R7I8 | 15-243 | None |
| A0A7V2KMI8 | 258-514 | None |
| A0A1V5KZE2 | 235-497 | None |
| A0A133U7Y0 | 148-332 | None |
| A0A1E3W9J3 | 40-230 | None |
| A0A842XAV0 | 13-290 | None |
| A0A7J9TGR2 | 17-231 | None |
| A0A0F8CML7 | 7-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.