DPCstruct | MC18622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 255 ± 62 aa |
| Standard deviation of domain lengths | 61.86 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A392NCP6 | 1-191 | MPEDDPFFITDGFRASVLVTAVETLQGYINTYDNLSSFPEIFLPILGLLREISEQKNMPNALRDKFKDVAELLKLKVDEHLALRRPL… |
| A0A7S2WXT5 | 33-258 | QVKVDSTEPGLLVFPKKTKAIGKALKTSKMAVEDVLDADVSSDDVKRFETAPFKVCALNFAYKTTVDLCDMHKKLPSAPELFEPLAQ… |
| A0A7R9H039 | 1-189 | None |
| A0A812R0A8 | 29-286 | None |
| A0A2U1JFQ3 | 870-1207 | None |
| A0A7S1V5W8 | 27-373 | None |
| A0A482VCS5 | 542-788 | None |
| A0A7S2XZ21 | 56-314 | None |
| T1KZ54 | 275-575 | None |
| A0A4Z2BJA1 | 30-221 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.