DPCstruct | MC18621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 201 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A523T289 | 15-232 | RQLSAIFMVSSIGCFFLLTLRIALTNSYRYSFLIWNLFLAWIPYIISNVMNFVYRKVHSEQRLRISMVTIGFVWLLFYPNAPYILTD… |
| A0A1I7HUT6 | 6-208 | LNPIHLVIGATGAIAFLLLLIRVKQSQSVFLLFLIWNLFLAYVPLIISNVITYFKLKKFSLPMSLIGWLLFLPNAPYIITDFIHLHK… |
| A0A0G0NE48 | 32-221 | None |
| A0A4V0YDF9 | 54-285 | None |
| A0A1F7J568 | 9-183 | None |
| A0A5C8LBD3 | 4-177 | None |
| A0A7V1RBL3 | 42-251 | None |
| A0A2D0N3I3 | 127-346 | None |
| A0A4Q2YFP4 | 24-222 | None |
| R2P1F6 | 8-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.