DPCstruct | MC18620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0291- CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A346R0I1 | 262-395 | YEVDFRLRPSGNAGPLATRFAGFADYQREKAWTWEHMALTRARVIAGDADLWERTTAVIEDVLCAPRDIVALRRDVASMRARIEAEK… |
| A0A833NKW4 | 1-128 | LRPSGEAGLLVTSLKAYEHYQLKSAWLWEHQALVRARSIAGDEALCQKFEIFRREILTQSRDEAYVREEVLKMRQKMKDHLGSSSEQ… |
| A0A350XPR8 | 414-547 | None |
| A0A533X9K7 | 315-463 | None |
| C8XBY0 | 281-415 | None |
| A0A336NCB7 | 105-239 | None |
| A0A523LYP7 | 394-538 | None |
| A0A831YD38 | 398-544 | None |
| A0A6N3UDR1 | 38-176 | None |
| A0A1F0CZP1 | 353-489 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.