DPCstruct | MC1862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 67 |
|---|---|
| Mean domain length (aa) | 59 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.87 |
| Pfam Score | 97.37 |
| Assigned Pfam label(s) | PF13511- PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6QAZ5 | 2-42 | FKCDGRQHCSQMRSYDEAKYFIKHCPNTKMDGDNDGIPCEG |
| A0A4Y8TCV0 | 9-65 | IDVGRSVNPSKPKYQCDGRTHCSQMTSCEEAAFFIRNCPGTKMDGDNDGIPCERQLC |
| A0A0G0XDZ6 | 145-203 | None |
| A0A0F2NF45 | 323-366 | None |
| F8J6U2 | 153-212 | None |
| A0A5C7XEE0 | 114-178 | None |
| A0A7U7GBR5 | 47-109 | None |
| A0A7T6ARU7 | 34-114 | None |
| W4LHP8 | 146-190 | None |
| A0A3N0V2I6 | 186-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.