DPCstruct | MC18618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 136 ± 19 aa |
| Standard deviation of domain lengths | 19.06 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3M5F1 | 1-110 | MATAEFVRRAVSALVGSSPEALDTLNELAEALGNDPNFATTMTNTLAGKQPLSAILTSLSGLATAENKLPYFSSKNMMALANLSAVG… |
| A0A833KPU5 | 100-239 | ETNKKAPLNSPALTGTPTTPTARQGTNNTQIASTAFVMAAIAALVDSSPDALNTLNELAAALGNDPNFATTMTNALAGKQPKDATLT… |
| A0A430BZ53 | 4-134 | None |
| A0A812RFY7 | 490-605 | None |
| A0A447JDY2 | 12-162 | None |
| A0A4R7MXL7 | 165-294 | None |
| A0A5C7PZJ3 | 72-183 | None |
| A0A377AHC1 | 1-159 | None |
| A0A844A272 | 2-118 | None |
| C3MAT4 | 2-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.