DPCstruct | MC18616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 156 ± 10 aa |
| Standard deviation of domain lengths | 10.29 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 42.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T0V755 | 66-225 | SRLAAINDLRSRFSVSQQGSDSGLLDLALTDADPRRAVRTLDAISEIYLTQNIQRQSAEAEQSLEFLEGQEPEIRAQLRSAEEALNA… |
| A0A833KNA4 | 1-171 | NYAVAERGKLTGVLGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLKFLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVT… |
| A0A6D0F8Y8 | 84-233 | None |
| A0A844W482 | 1-160 | None |
| A0A7H4P0G0 | 1-131 | None |
| A0A5C7PWW3 | 228-387 | None |
| A0A0C2N1M7 | 647-806 | None |
| A0A7J7BT29 | 354-511 | None |
| A0A4P6RT70 | 45-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.