DPCstruct | MC18615
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | CL0475- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538CYW6 | 562-664 | GGYQLVGRTVQVWNRHCRGPHFDQPWLLRNFDQIQFHPVGAEELMEQRHAQTRGELAIKCEPTVFRLSEQRSFLREHRDEIAAFKAR… |
| A0A833KLJ3 | 1-130 | YQFVGRTTQMWSRYRKNANFEEGKPWLLRFFDQVKFYEVSETELLQMREDFKAGRLQLRIEDGVLNLKEYNEFLKTHQDSIQAFKDM… |
| A0A0D0LJR0 | 50-158 | None |
| A0A132B4Q1 | 7-130 | None |
| A0A651GTN0 | 781-884 | None |
| A0A3S5DFF7 | 533-650 | None |
| A0A817K7B9 | 11-138 | None |
| A0A817EDP9 | 1-145 | None |
| B5I525 | 729-853 | None |
| A0A663ASB6 | 683-807 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.