DPCstruct | MC18614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 172 ± 24 aa |
| Standard deviation of domain lengths | 23.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 32.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3G2K7 | 285-436 | MPPYVIIVPSYGEIGFCWEPVEGTNIYGRGRVVIPTFSRKGVEPFYQAFGDYRWKLEKELSFGRWMEEGLTGEYYRYLEENKIKGNP… |
| A0A7C5YE55 | 1-133 | EGLNIYGRGRIVIPLFSRKGDEPFYQAFGEYRWKLEKELSFGRWMEEGLTGEYYRYLEDNKLKGNPAEYFVKDYVLWVTKEVSGVQK… |
| A0A098QYR4 | 788-987 | None |
| A0A3R6P9K7 | 333-537 | None |
| N1U534 | 1-206 | None |
| E0RR93 | 366-519 | None |
| W5SQR2 | 83-224 | None |
| A0A847CDG1 | 82-237 | None |
| A0A7X8J060 | 215-370 | None |
| A0A7Y5BKW0 | 536-707 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.