DPCstruct | MC18612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.66 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF02625- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7LAH2 | 119-216 | GSVRADAAVTDDARGLLALGRSEILEYGPDGQRRGEGMEIFVSSFAPRPRMLVFGAIDFAAALARQGSFLGYRVTVCDARAVFATRA… |
| A0A1Q3SZ54 | 48-137 | GSAELDQGAVAKTLELMQRTGSKTYPIETPEGQFEVFVDVFPPPPTLLVFGAVHIAIPLVKFAKECGFRTKVIDGRQKFLTKERFPE… |
| A0A7V5YYD9 | 170-274 | None |
| A0A535JYQ0 | 152-246 | None |
| A0A381YEQ8 | 2-78 | None |
| A0A499VN23 | 1-107 | None |
| A0A829I0I2 | 8-114 | None |
| A0A2G5J4B2 | 108-199 | None |
| A0A0F2PK03 | 36-137 | None |
| A0A4R1I7D1 | 48-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.