DPCstruct | MC18610
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 132 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.78 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0CIC6 | 23-144 | MRLNGAPAGALAPGASGSFASTPAEKKAAANTIETELQPNTKIAAEHADESTNTAVKGFEGWDTAPGLKKVADTWDQQVVVLMGRLG… |
| A0A4S2RTU3 | 1-114 | MGPFVPGGSGDFASTPAQKKAAAGTIETELEPNTKKAAEHADADTGTAQKGFEGWETAAGLKKVADTWDQQVKNLMGRLAAEKTALR… |
| A0A2N3VZ86 | 3-150 | None |
| A0A1R1SJ18 | 27-144 | None |
| A0A6I5H429 | 2-104 | None |
| A0A4Z0HEC3 | 26-137 | None |
| A0A2G1XCS2 | 6-149 | None |
| A0A6N7IBK0 | 3-129 | None |
| A0A7K3DQY3 | 1-127 | None |
| A0A2S4XL66 | 43-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.