DPCstruct | MC18609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 223 ± 31 aa |
| Standard deviation of domain lengths | 31.08 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14912 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5JCC4 | 41-271 | HIPNRPEYHNSWGRGSIIWELPTKSFFSYPSPRIESLAEPKQLQEEYLQKRPYSSPEWHVKDPSVTPEASVRIVQLSVAKSTHPDFV… |
| A0A0L8HIP3 | 3-164 | ANCSRRLTDLAVSKKFHPLFIAPRPVQTEVPLSARNVKPSPRIIVLALPVPRKITTKIQEGEKSNSHKVKQASVSSRTYPRLEKLAV… |
| H0VC56 | 131-356 | None |
| A0A7J6BE64 | 7-225 | None |
| A0A6I8W543 | 55-300 | None |
| A0A7J8K1T2 | 246-512 | None |
| J9LA14 | 6-265 | None |
| A0A2Y9MJD9 | 188-454 | None |
| A0A7J7J671 | 5-200 | None |
| A0A835NE33 | 29-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.