DPCstruct | MC18608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 56 ± 2 aa |
| Standard deviation of domain lengths | 2.48 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 65.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 86.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06624 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5ISU6 | 1-54 | MVAKQRIRMANKKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAK |
| A0A7M7NPB1 | 1-55 | MPSKQRMRTQNDKASKNVEKRGNVPKTLKASEEGYPVGPWLIGLFIFVVCGSAIF |
| A0A6F9DSN4 | 1-55 | None |
| A0A6J3J6Z6 | 1-57 | None |
| A0A6F9AYG1 | 1-55 | None |
| A0A3P9K409 | 1-56 | None |
| A0A7J5Y0M7 | 1-60 | None |
| A0A6P8GE40 | 1-53 | None |
| A0A4U1EP16 | 1-60 | None |
| A0A1D5RKH4 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.