DPCstruct | MC18606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 15.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6CML2 | 81-225 | LLQVIEELLRMYKVHQERIVEAYDRLQFEYSSLVNQSDITSQHVEVHILRFESKVGPISFLVRLPVDFTRIPPFLSKDNPGEDSAIL… |
| A0A7J8FF40 | 2-124 | FEYQTLLEEPQYGENMEIYAGKKNNWTGEFSARFLLKLPVDFSNIPTYLLKDVNEDPGEDVALLSVSFEDTEATQVYPKLYLSPRIE… |
| A0A3S2LP93 | 119-252 | None |
| T1JCT0 | 3-146 | None |
| A0A7J0F3M8 | 98-290 | None |
| A0A482VJQ7 | 129-274 | None |
| A0A7J5Y592 | 2-152 | None |
| A0A653CP54 | 114-249 | None |
| A0A6B0RGB1 | 154-298 | None |
| A0A1X7U399 | 114-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.