DPCstruct | MC18605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 90 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.86 |
| Pfam Score | 40.00 |
| Assigned Pfam label(s) | PF00122- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FEG7 | 13-110 | IPISLYVSIELVKLGQVFFLHHDLDLYDEETDSPIQCRALNITEDLGQIQHIFSDKTGTLTENRMVFRRCTVMGREYPHQENAKRLE… |
| A0A0R3SLN2 | 15-94 | HTIIPISLQVTLEVVRFVQALFINWDLDMYDAKTNTPAMARTSNLNEDLGQVKYIFSDKTGTLTKNVMKFKMCSIGRDAY |
| A0A821SW20 | 57-152 | None |
| W0TYM0 | 580-675 | None |
| A0A4Y2V7C1 | 5-91 | None |
| A0A6G0QMA7 | 2-87 | None |
| A0A7J7E2P7 | 54-163 | None |
| A0A2U1PYS1 | 152-235 | None |
| A0A3Q3VWB9 | 364-444 | None |
| H8Z9I2 | 321-396 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.