DPCstruct | MC18604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 289 ± 35 aa |
| Standard deviation of domain lengths | 35.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 42.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8FE84 | 13-310 | AALDLQLRLSPAASERPLWDASLRTPSCLEAFRDPQFQGLLQHLLRTKASGTAERLAPLHQLLQPMAGCARVVQCAEAVPTLLQVLF… |
| A0A1S3QLC7 | 1-241 | MDRLSVLHDLLMEAADWSRVIQSAQSVPVLLHVYFNTVTTVSDERLLAQLVLVLLERSSLLLHIPRYTAEIHRVFSHHLLKLCKLHP… |
| A0A443PRP8 | 50-281 | None |
| A0A5A7REQ1 | 258-562 | None |
| A0A6P8HCK4 | 472-745 | None |
| A0A1R3KAH3 | 199-529 | None |
| A0A0A9DN92 | 33-290 | None |
| A0A811QVZ1 | 2-280 | None |
| L8GXG0 | 406-722 | None |
| A0A061F629 | 710-1054 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.