DPCstruct | MC18603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 77.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8F4C1 | 1-62 | MDTADDGSRMPEPWDSSLALYVYEYLLHVGAQKSAQTFLSEIRWEKNITLGEPPGFLHSWWW |
| A0A2S2Q2D0 | 1-63 | MYAKGKSAAVPSDAQAREKLALYVYEYLLHIGAQKAAQTFLSEIRWEKNITLGEPPGFLHSWW |
| A0A6S7FML0 | 46-108 | None |
| A0A151PHZ0 | 37-103 | None |
| A0A6P6RKC1 | 1-63 | None |
| A0A5K3F362 | 1-63 | None |
| A0A452DNL5 | 1-52 | None |
| A0A5F4C3T0 | 2-57 | None |
| A0A1I8H9Q7 | 1-63 | None |
| A0A1B0GRS0 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.