DPCstruct | MC18601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 98 ± 20 aa |
| Standard deviation of domain lengths | 20.12 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 92.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A514XNY4 | 116-204 | MGWHWVDFRSPEFHGQPFTTTYIYGFYNGEMIFLEPMIARSFLQTKPQFTKEVPLPKSVAKPGNYPANYSLMYDSVQDLYWLSLEKL… |
| A0A1G5XEK6 | 19-108 | MGVHWINPLSPELAGETFTRTFIDGTYKEKVAFMEPMITLDYIKSKPSHLDEIPLPTHFQVYGFYPSKYRVSYNPSRKEYLIMLTDF… |
| A0A218Q963 | 187-265 | None |
| A0A419ZNC5 | 72-153 | None |
| A0A3C1UK14 | 91-179 | None |
| A0A1P8YQC2 | 6-83 | None |
| A0A1Z4K0K7 | 190-278 | None |
| A0A2T6DN02 | 243-350 | None |
| V4HPY8 | 304-447 | None |
| A0A848L7L3 | 116-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.