DPCstruct | MC18600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 163 ± 29 aa |
| Standard deviation of domain lengths | 29.05 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 28.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M0AQ39 | 6-151 | IANDAVNAAKIQNGTVGTAELANNSVTNQKIANNAVNAAKIQNGTVGTAELANNSVTNQKIANNAVNAAKIQNGTVGTAELANNSVT… |
| A0A7G5BV32 | 5-142 | IWQTAALGGAKLGYGSVTGEFLADGSISGAKLENGSVTGEHLADGSISGARLEYGSVTGEHLADGSIGGAKLENGSVTGEHLADGSI… |
| B9XBJ1 | 154-287 | None |
| A0A5Q2NIL9 | 296-454 | None |
| A0A258KYE1 | 340-505 | None |
| A0A1Y6C4J4 | 155-337 | None |
| A0A497P4P6 | 30-156 | None |
| A0A1G1A3U9 | 30-222 | None |
| X4ZFC6 | 17-132 | None |
| B8IKY4 | 105-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.