DPCstruct | MC1860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 192 ± 11 aa |
| Standard deviation of domain lengths | 10.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430DZ61 | 192-373 | DPGKPVAVIGNPPFGHAASMALKFIQHAACCPDVEVIAFILPLSIRKAGIQNRIDANFDLVCDQRLPANSYIFRGQDHDVPTVFQIW… |
| A0A2D6P5W2 | 2-194 | RFSLAIINPPYGVGGNLAIRFLNKLSEHTDDIRAVLPTSVRKPSSLNKIVGHLHCDVDEDLDPSTFPGGISAVKQYWKVKNTSRFAI… |
| A0A4D8RFD5 | 5-220 | None |
| U2Z819 | 137-320 | None |
| A0A087E895 | 97-276 | None |
| U3AR36 | 3-191 | None |
| A0A6C0HPM4 | 174-356 | None |
| A0A0T9PTD8 | 75-265 | None |
| A0A1G3K8F6 | 136-319 | None |
| A0A2G1MCY5 | 89-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.