DPCstruct | MC186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 111 ± 25 aa |
| Standard deviation of domain lengths | 25.00 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19746 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S2S612 | 48-152 | MWVDAPGHARPIDGVDPAAYAAVPTQALPAPDSVERQLGPRRPPGWVLEPLRRRGPDRGVIHAVDCPDAPRDRPALTWQQALDHAER… |
| A0A285DP35 | 24-140 | MWATDSASEQVEPREYRVWLPPDHVRRPEGVSYDDVPTVPLPEANQGDDSGRWGWKVQRVPPRQGLSGGVVVHVWDCQEAPEGNEEI… |
| A0A2N3VLZ8 | 67-170 | None |
| A0A515XXU1 | 1-100 | None |
| A0A243Q548 | 1-106 | None |
| A0A2S4Y7X2 | 18-117 | None |
| A0A2A2Z666 | 1-90 | None |
| A0A542QII0 | 17-188 | None |
| A0A5B7VAA6 | 1-88 | None |
| A0A0X3W197 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.