DPCstruct | MC18599
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 112 ± 18 aa |
| Standard deviation of domain lengths | 17.50 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 93.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03860 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G9C7M0 | 1-96 | MRACAEALLATRQCANACIRSGDRTLEACALLDLDCADICEATLGALSRQSEHHGDFCALCAHLCRACAEECERHSHAHCKRCAQAC… |
| A0A495MCZ6 | 41-141 | KKFKLAVEACLACFGACELCAALCIEMNDKNHQRCISLCRDCAEICILCVKFCSRNSTFSSGLMKLCAKICTACALECEKFSHHPHC… |
| A0A7W5MFY9 | 2-85 | None |
| A0A5C1ALF7 | 37-153 | None |
| A0A6M1L5H0 | 401-522 | None |
| A0A1G7AIK7 | 2-96 | None |
| T0BRA1 | 133-237 | None |
| A0A838N8T4 | 1-101 | None |
| A0A511N1L1 | 11-117 | None |
| A0A7D5GAW6 | 14-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.