DPCstruct | MC18595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 185 ± 46 aa |
| Standard deviation of domain lengths | 46.07 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 69.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A097IJN5 | 2-251 | KSTQKLIPAAVAFLGMAALSACSGTEDGSTGTASSSVVVTSIQSSETPSTSVETVTATDPASNEQPAPERQAAGGCDPADFQAAGFS… |
| G7GM86 | 2-179 | TRRSPRIAVFAATAALAVTLAACGSEDDATDASSSTAVASSTASESASATSSVSSSAKASKTPEETDDLRTENPSAPIVGGRVPASR… |
| A0A022LDD6 | 61-223 | None |
| A0A5C7XPR8 | 5-121 | None |
| A0A2N6T2J4 | 1-173 | None |
| A0A4R2QPF6 | 14-169 | None |
| A0A7T3Z4G8 | 82-363 | None |
| A0A3R8VVW6 | 1-265 | None |
| A0A656WII3 | 1-167 | None |
| A0A1E7PMG4 | 9-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.