DPCstruct | MC18594
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 168 ± 32 aa |
| Standard deviation of domain lengths | 32.23 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 76.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06978 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0QF91 | 4-119 | RTIDIEKFIQARSQEIYHFTKQIEQKKIFQSKQPYQSVPKHLRRRAMSHNRYRIPLRIRAKMSEKELDQQEMGQDPISCRKNIRKPK… |
| A0A1R1YP78 | 27-169 | AIDIVNFVESRAYEVCAMENAITLSKKSNNARAFQTLPRHLRRRAASHNIKRVPIRLRAKAIAEMKQSLSEKTKSKTVSDPSIDLLK… |
| A0A182TTI3 | 1-164 | None |
| A0A317XSJ2 | 69-228 | None |
| A0A1A9XUW5 | 2-108 | None |
| A0A4Y7NIK7 | 9-188 | None |
| A0A7R9KPW0 | 19-178 | None |
| A0A0C2MEC4 | 1-144 | None |
| A0A5B6YLT0 | 6-188 | None |
| A0A061DBK3 | 2-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.