DPCstruct | MC18593
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 125 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1XL42 | 67-201 | SVIIPIATYGGEIFGMSQSRINKIQKVVDSASRLVIGAGKAVALTRLREELKLSTVNIKASVARERAYIKWANSKTWIAELIEKPMK… |
| A0A1R1YLQ1 | 6-140 | YGGETFGMSEARFKPIQSEIDKAIRIVANVDKSAAMERIRDELGITSMFMRTITARELAYHKWPTSKTWIADLIKAPMKARMATWVN… |
| A0A2T9YL93 | 17-137 | None |
| A0A2T9YQ33 | 5-136 | None |
| A0A2T9YTH9 | 728-860 | None |
| A0A2T9YTX8 | 84-188 | None |
| A0A2T9YWB9 | 59-183 | None |
| A0A4Q9LGR5 | 2-138 | None |
| A0A1R0GLB5 | 2-106 | None |
| A0A1R0H7D8 | 8-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.