DPCstruct | MC18591
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 133 ± 17 aa |
| Standard deviation of domain lengths | 16.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T9Y426 | 15-134 | VHFSTSAVVPKNELSNQNNNVKIIVSKNRSSRSKNRRYKSYLNKGKYWFWEGESDDKFLIKLRYKPKNYFGQRFEYLFENMREFKNR… |
| A0A1R1YER1 | 1-135 | MKITFIGLALAFSAIFAVSASPVVEDSLKNDQSGTVLKRSGSYRGGRWGRGYRHGLGHGYYRFGRNWYFNSLSDTSFINSLVYRPLV… |
| A0A2U1J500 | 1-119 | None |
| A0A1R0GSU3 | 330-473 | None |
| A0A1R0GSQ5 | 283-416 | None |
| A0A1R0GR87 | 1-144 | None |
| A0A1R0GPM0 | 176-308 | None |
| A0A1R1XMT5 | 1-128 | None |
| A0A2T9Z7V9 | 159-251 | None |
| A0A1R1YE14 | 59-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.