DPCstruct | MC1859
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 181 ± 13 aa |
| Standard deviation of domain lengths | 13.33 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D6KXH5 | 2-190 | TNLDFKGFFGTLESWGLTDALLPFLLIFTIIFAILQKTKVIGEDKKNIHVVIALVIALLVVIPHIINPGGPADVVGIINQAIPHVSL… |
| A0A2G9MS19 | 2-169 | PFILIFTIIFAVLQRTKILGKDEEGKPRKNFNVIISLVMALAVVIPHVTGRYPYGLSVVDIINEALPNVALVAVIIVMILLIIGVFG… |
| A0A3M0XG07 | 1-193 | None |
| A0A5E4JVK3 | 14-184 | None |
| A0A3M0Y6V2 | 17-178 | None |
| A0A1J4XP34 | 1-199 | None |
| A0A1J4XNU5 | 1-205 | None |
| A0A2T9WKU1 | 1-192 | None |
| A0A7T5R7S9 | 1-175 | None |
| A0A7J4L8W3 | 1-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.