DPCstruct | MC18589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 174 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.76 |
| Pfam Score | 96.77 |
| Assigned Pfam label(s) | PF07093- CL0028- CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015LQ57 | 13-192 | DAVVYSIYFPLPTSDQISFLQEISTLILSDLNQYLNEYIWQKDPFELRIAKNESDPSYPFLHGKTRFGDCIDDEWFIVFLLRQISLK… |
| A0A1R1YCR8 | 1-181 | MFEDLNKYEGNFINYTLFPYIEDLPNTPFEGRISTYENILDDLQLKLYEYVEEKILGFIWNQDKPPSITGTVFFGDSMQDEWLMVWI… |
| R1D4X2 | 5-193 | None |
| D3B137 | 113-288 | None |
| G8BED9 | 24-183 | None |
| A0A194V2Y9 | 15-205 | None |
| A0A3Q4HB40 | 1-149 | None |
| A0A1E4SJY2 | 27-194 | None |
| A0A1E7FT62 | 33-229 | None |
| A0A836ATU3 | 1-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.