DPCstruct | MC18588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 108 ± 18 aa |
| Standard deviation of domain lengths | 17.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01425 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J0LVJ1 | 577-669 | FRGLCLEVAEVSWPSLPLALNAYYILAPAEASSNLARYDGTLYGHRAEGEELWPVVEATRARFGLEVKRRILVGTFVLQSGYYEAYY… |
| A0A1R1YBL9 | 19-116 | KAWKFVANVLKDLGATLKSVSLPHTKYGLSAYYTITAAEASSNLARYDGIRYGARKDILNTSDDIGSDASNKYSIYRESGLGPEVKK… |
| A0A7R9A5S4 | 480-600 | None |
| A0A2H0TTW9 | 47-140 | None |
| A0A1Q9SYA3 | 60-190 | None |
| A0A812XLJ7 | 179-326 | None |
| A0A3T0Y475 | 238-378 | None |
| A0A6N6XEM8 | 38-132 | None |
| A0A0G1J528 | 250-359 | None |
| A0A7V5C9Z9 | 19-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.