DPCstruct | MC18587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.94 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 63.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0M794 | 245-310 | ETGSELSKTVAIFIVQKILLDDNGLNYICATYERFYAVGTVLSNMVAQLVEQQTARLLKHVVRCFL |
| A0A1R1Y7D6 | 1-71 | MDIGSELCKVIATFIFQKIIADPGGFHYVTSHSKRLKTVVMILNNVVSQLVESRSVRLLKSVTKCYLRLAD |
| A0A2N5V700 | 81-153 | None |
| A0A2G2X1R4 | 62-133 | None |
| A0A7S3J686 | 1-68 | None |
| A0A4U5MDH1 | 184-255 | None |
| A0A2R6NN35 | 1-81 | None |
| A0A4S4KGV5 | 1-74 | None |
| A0A7S4ABW0 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.