DPCstruct | MC18585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 310 ± 25 aa |
| Standard deviation of domain lengths | 25.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 32.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I5AHQ2 | 3-268 | EVRTAAVAAGAAAALGLAQVAVAELTGITTLGGDFTAGADRVQGVQVTLIAWYCAVAVPLAVAVAVARPGVDARMRKVSVLPASAGT… |
| A0A6N7GCN8 | 1-341 | MAIRGWGGSVAVAIGVGAAVGAAQLGLGYGLDVISFAPDTGGRLSTEGWVTSLTWATWIAATSTIAGAIVADRLSGRGPATGPATGP… |
| A0A841FQD6 | 1-316 | None |
| A0A4Q7WB19 | 1-311 | None |
| A0A7Y6CS71 | 1-328 | None |
| A0A109IQ42 | 1-326 | None |
| A0A385AK76 | 198-527 | None |
| A0A810MI10 | 1-310 | None |
| A0A3D9ZDK7 | 1-310 | None |
| A0A6V8L8V5 | 1-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.