DPCstruct | MC18584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 100 ± 30 aa |
| Standard deviation of domain lengths | 29.84 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0660 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K0GXG5 | 1-75 | MRASDEDRQRIMAALERHTGAGRLTLDEFTQRVGVAADARTLDELAAVVSDLPAEEAEERQRREFLLLLAIAVVT |
| A0A6N7GBZ1 | 2-82 | TGRSRLRAADTDRQATAERLREAAAEGRLDLDEYDHRLRQAYAATNYADLDRLTFDLPTPPPARPAAGTGRAVPGQVQAAA |
| A0A2T8F5X4 | 116-232 | None |
| A0A6G7Y5B9 | 2-102 | None |
| A0A0X2NNK1 | 4-118 | None |
| A0A358SJ66 | 386-450 | None |
| A0A4Q5J2T6 | 111-214 | None |
| A0A3D5DMP9 | 35-151 | None |
| A0A852V7E5 | 1-123 | None |
| A0A2T0Q8B8 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.