DPCstruct | MC18581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 311 ± 36 aa |
| Standard deviation of domain lengths | 35.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9ESJ7 | 1-300 | MGEYMKGFVAIRPSDAFFWNKEYLERFYKTQSADTKEKIPGYYYMQKIIEFDCDHTESGELYREYVKHGCLEKKNQLCDWCKEHNFV… |
| A0A6S7J5R5 | 24-337 | GFIASAVSERPGVEFFYNKEWLTKYNITSTTKRPEVPGHSYFQKVEKFFEMHYERGELYMEFLKKDCLSKVGRSCNACTEWIGPEST… |
| A0A6J8DA71 | 164-486 | None |
| A7RR29 | 221-517 | None |
| A0A6J8EB34 | 125-374 | None |
| A0A8B6BUL1 | 524-865 | None |
| A0A6S7H4D5 | 756-1077 | None |
| A0A2B4S5K9 | 113-438 | None |
| A0A7D9DT63 | 246-572 | None |
| A0A7D9JGR4 | 340-713 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.