DPCstruct | MC1858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 10.84 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14325 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A9WL24 | 3-112 | TSPNRLLATIFGAVYLLVGILGFFVTSGIGFAGTKGNNLIIFAVNPLHNVIHLAIGAALLLAGLSSTTAAKGVNVAVGAVYLLVGIV… |
| A0A2D6EVW1 | 3-111 | LQKKFATGLGAVLLIVGIWGFVANSVLIFDVNTAHNVLHVITGVLGLAAGLGAGAQAKTFNVIFGLVYALVTVLGLLNVASVVNLLN… |
| A0A2V5ZSP4 | 60-200 | None |
| A0A7Y3CTC1 | 34-176 | None |
| A0A3B0C875 | 17-137 | None |
| A0A6G3ZPV4 | 7-134 | None |
| A0A254QDS2 | 48-175 | None |
| A0A4R4AB69 | 2-114 | None |
| A0A2R6E2N9 | 6-130 | None |
| A0A7Y2QZK1 | 8-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.