DPCstruct | MC18577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 187 ± 39 aa |
| Standard deviation of domain lengths | 38.64 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6TM70 | 53-248 | LKTHVITSKKEKIVTKSQSLCSLQPENEAQEIAKGHGTMISVLQSRLLRLKAAQTLWHKDTNALIEYLLRLKDDAVLVDIMPFLTCR… |
| A9NZH1 | 1-161 | MQQHHSFTSILQTRLTKLQVIRRFWQRNDLKGAIDATGKMGDHSVSADVISVLIERSEIFTLDICTVILPLLTRLLQSEIDRHLTVA… |
| A0A834SMA2 | 1-142 | None |
| A0A0D9XL08 | 280-485 | None |
| A0A4Y7KS17 | 30-208 | None |
| A0A5N6NM39 | 44-166 | None |
| A0A7S3MGR7 | 1-145 | None |
| A0A6V7Y9C2 | 46-322 | None |
| A0A3B4DIL1 | 216-451 | None |
| A0A7S2KYE6 | 10-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.