DPCstruct | MC18576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 223 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 23.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484CCJ9 | 75-277 | VLLTGEENEEEIKRKVREITKQLRRGRTSPLISSTICVSQIPNSVRYYGVSMSTAGRIPGRIMVAASCLSFWDSYVAGAVMTYYPNK… |
| A0A3M6TJB2 | 46-272 | LRYRVSDITQREGVPKGSTEHAQEVKEQARSLLSSLPKVFRPKVLAKVSHNGESFVGASIAVSDFLRPLYLHKRIADFRKPSLREAI… |
| A0A4Z2ICH2 | 6-198 | None |
| A0A3M6URH1 | 14-245 | None |
| A0A2B4RN93 | 55-262 | None |
| A0A2B4R7L5 | 164-392 | None |
| A0A7J6ADD0 | 4-208 | None |
| A0A2I4D8K4 | 224-434 | None |
| A0A444UQE2 | 713-953 | None |
| A0A5N5J6U3 | 86-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.