DPCstruct | MC18572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 137 ± 26 aa |
| Standard deviation of domain lengths | 25.54 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19927 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q4TNZ0 | 59-244 | IARAVGSQPLAGDVVGTYWLGGSLLERVDPAVLLSDLRTAFTGQVSGLLDDVPVSKAVLAHHSFHVLVVYPWIRFLDRSPDTALHVL… |
| A0A0G0YS22 | 13-139 | FVAELKKSKPNKFIPTHLFQVLHVGVGRASGSVPYNLESINNCMIRWGKVEKVNRKTAVVNLNSLKKVRGGYKRTLITETFPFVEGF… |
| A0A0G1D8I5 | 441-555 | None |
| A0A3R7HC67 | 24-210 | None |
| A0A1G1Y2Z2 | 41-197 | None |
| A0A846SUB7 | 111-238 | None |
| A0A7V5EYB9 | 213-327 | None |
| A0A838H1Q3 | 9-149 | None |
| A0A2M8KCT2 | 96-201 | None |
| A0A7V9K6W2 | 36-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.