DPCstruct | MC18570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 228 ± 31 aa |
| Standard deviation of domain lengths | 31.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6EWV0 | 1-171 | MPTSWLAGDAASSISVNLPASLQGTTIPTLLKEDAHQHLQKTSDVRDFFDFLLIAQNELPAEQLNAFALQQITAQLTSAAAIQEALD… |
| A0A1I0F881 | 1-232 | MPTLLPTSQVTLRRLPPPAMLTVTLLLAAWLINGAGPVGVMAPADPGAGQYIRAEALSDSQQIAFAPVDRAIHRLRLDGKERPDQFE… |
| A0A1I3NRS3 | 5-255 | None |
| N6WP20 | 1-253 | None |
| A0A3R8T2N6 | 38-283 | None |
| A0A2K9LJH8 | 2-189 | None |
| A0A1F4JGS9 | 1-252 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.