DPCstruct | MC1857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 203 ± 21 aa |
| Standard deviation of domain lengths | 20.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 31.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5XCE6 | 3-208 | LFSFGKKKKKPEQAAPGSPIEQIMALKQQGMVDDQIIKELERQGYNSSQIFDALNQVNIQAPTSAGQPPGYNMPSPQQDLSYEQPPP… |
| A0A7J4J631 | 10-187 | AVSTVLQLRNQGLTDDLIMDEMARQGFRPETVSQALSQADGSADMGMASSSYGRMGMMPPSAPLSENPQNDMYSRMEDIAENLIDEK… |
| A0A5E4JP11 | 1-248 | None |
| A0A842UG49 | 1-204 | None |
| A0A842NQE7 | 1-234 | None |
| A0A7C1MKY9 | 1-198 | None |
| A0A7J4JF37 | 29-237 | None |
| A0A842UY58 | 34-220 | None |
| A0A842UZD4 | 41-265 | None |
| A0A7C3ZGE0 | 1-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.