DPCstruct | MC18569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 147 ± 18 aa |
| Standard deviation of domain lengths | 17.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06996 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A828FJ34 | 83-250 | IATPVSRFLALLPLMLLPGRTTEGLTSLVTLLAPGTQARVWHHDRRRIPLKTPLAMRVHHPVSLKSRPVMGDHATDVNGQVLLQLST… |
| A0A3D4YD11 | 173-342 | VSDRTLLSYHDVLWRRPRSTHGLVKVLSTHFNMPVEVHQYQGAWERAPESEITKLGQKLGRMNALGTEVILGDKVWNQSAGIRIDMG… |
| A0A4V1XRP7 | 955-1103 | None |
| A0A1H4BHJ2 | 369-505 | None |
| A0A658Z4L1 | 8-170 | None |
| A0A379FGM1 | 6-162 | None |
| A0A376DYS5 | 7-122 | None |
| A0A6M1I3Q7 | 7-125 | None |
| A0A399I9Y7 | 182-332 | None |
| A0A7Y4WEP6 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.