DPCstruct | MC18567
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 62 ± 13 aa |
| Standard deviation of domain lengths | 12.95 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3BDM9 | 1-43 | MPCIYICGECGAENEIKPKEPIKCKDCTYRIMYKKRTDRMIQF |
| A0A5M6C135 | 11-68 | NPNPMPDRNIPKPPDTIEYICGDCGAKTAMKPSELIRCRECGHRVMYKPRTTRIVQFE |
| A0A0H2RMJ8 | 7-75 | None |
| A0A4Y1RD80 | 58-122 | None |
| Q4UD38 | 1-48 | None |
| A0A445J1W1 | 1-46 | None |
| A0A1V2LRL2 | 9-72 | None |
| M9MGN2 | 1-72 | None |
| F6HCN6 | 1-46 | None |
| A0A813VF57 | 241-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.