DPCstruct | MC18566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 3 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0012 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M6BWK2 | 3-78 | PKGATSHPPKPPSNVPLSAAAQQQRANSAGIAEFELPKTNLTKLAKGSIPDNVKMQQDVVLALLRGSTVFISYLTA |
| M1WIW4 | 12-104 | LPARTRLVDKAPSASASVEGLPGSSGSSGTGGSKEGREKDKEKEYVTIEDLALPKSIITRLAKGVLPPNAQIQATAALAMSKSATVF… |
| G0SEX0 | 50-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.