DPCstruct | MC18564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 230 ± 8 aa |
| Standard deviation of domain lengths | 7.98 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 81.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G7K683 | 7-242 | HIARIAGFKAKMSAVTHCARGHRYSPDNTYYSCNGTRRCKTCNLQAQKRVKPITPKMIEKAKRSLVSGYSVSQIIRGDDRSMNPVQW… |
| A0A1I4LR24 | 133-353 | EANRKAADALKAPKGSKEKTHCLRGHPLSGDNLGFKRQGTGRYCKACNLARLKTAGTFHPAQIERVKLLLTNGVPLTHITGSRKKGG… |
| A0A7S7QMV2 | 258-489 | None |
| A0A1H4NIS2 | 57-293 | None |
| A0A1M5UJ06 | 94-334 | None |
| A0A0R3M4F1 | 64-293 | None |
| A0A7W6X3Z0 | 1-218 | None |
| A0A810BRB3 | 207-433 | None |
| A0A1N6LDZ5 | 73-290 | None |
| F7QMI0 | 178-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.