DPCstruct | MC18562
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12636 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R5MTK3 | 4-81 | QKVILKHICYTPLVYERINKKLAARLTHQQIEALLIKTIETASQIERRGKNFYVVNSEQQIQVTVNANNYRVITVDRL |
| A0A3Q8C9A3 | 5-87 | NFDKYKLSDHAFERIQARFNIPRSEAYTWLRRLLENAEFVRIDGDGCELYKLKEVRIVINPLTHFVVTVYQADTLQDQYYREM |
| A0A162FNN1 | 133-212 | None |
| A0A7C6UUN1 | 15-100 | None |
| F1TEY8 | 74-155 | None |
| A0A1G5FJI5 | 160-239 | None |
| A0A1T4V2Z7 | 23-101 | None |
| A0A268IPI6 | 4-102 | None |
| A0A397RW53 | 3-85 | None |
| A0A3M1CTN3 | 11-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.