DPCstruct | MC18560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 5.81 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0097 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A656YVP4 | 12-87 | MRSEEELKNLLNQIDGKGYGAYKKLKGSYEIGEYQLFVDHVQGDPYASPSRFRVRLIQLKAGFPVELFETETRKIA |
| F3AKJ3 | 1-81 | MKSAQDLRKLLNEIHRKSYPAYKGTKGSYRFADYILQIDHVQGDPFASPSKVSVAIDGQLARFPKQLFDKKYKRIALQDYL |
| L1J557 | 32-105 | None |
| A0A239BA59 | 1-76 | None |
| A0A140L1P3 | 1-76 | None |
| A0A2C9ZSL9 | 2-70 | None |
| K1XZX2 | 3-74 | None |
| X1JIQ8 | 4-73 | None |
| B9KXZ8 | 1-64 | None |
| A0A0W8DQL1 | 55-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.