DPCstruct | MC18557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 166 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q9XWX0 | 9-164 | YDFNQFLDTAREMNIREPPDVVIFCELIYGAAITCLKKFFLRDVFKIFITSHKANIDLMDVVIKSFTDSTNSGKLSKAWAHAQNCHT… |
| A0A6G0V1L8 | 35-206 | VTEWAVQTKDEEKFYDSEEFLKDANKYFSMSLPNLIQTSARLWLACVYMVKDYYLQIGIHAVSHRSLKFLMKFAVNYSSTFGMISDL… |
| O62079 | 546-712 | None |
| A0A6V7X0D1 | 171-339 | None |
| A0A1I8BUH8 | 6-173 | None |
| A0A1I8BVG7 | 102-268 | None |
| A0A1I8BW72 | 1-158 | None |
| A0A1I8C1Y4 | 115-295 | None |
| A0A1I8BYN3 | 69-203 | None |
| D8FRP3 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.