DPCstruct | MC18554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 190 ± 22 aa |
| Standard deviation of domain lengths | 21.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 19.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4ZC17 | 27-215 | FLHAQYLFQNRLNLSDSSNWNNPSSLSGELNKIYINGYNGSNGLVETCNAYAQMGSYLNKKGISLSDCISTIFILKSVEKPYNALLY… |
| Q95Y74 | 18-210 | SQLCISKTLTFCQYGFNQNLNITSATADWTNPGTLSFIIRSYYLQGIDGLLSVCNARQQFDQCLGDQYDACMSRLNFITDGESPADA… |
| G0PEA1 | 6-168 | None |
| A0A2G5U0B5 | 44-201 | None |
| A0A158R1F5 | 79-254 | None |
| A0A2A2K0P8 | 206-416 | None |
| A0A2A2K165 | 490-699 | None |
| A0A2A2K1V9 | 44-253 | None |
| A0A3P7XG81 | 8-182 | None |
| A0A2A2KSJ9 | 245-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.